DPCstruct | MC7892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 22.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4SAY1 | 8-113 | DAQAIAGAVGLVANGVTSWSLWVLYNTGCGLPPGPGGSLGALEGVSYLVVTAFVVAATAKKIKTGSGLPAGPGGVLGGAEGISFLVA… |
| A0A5J4XXA9 | 14-127 | KTKATAEPDSTLTKAVVAAGLVANPVVLVSEYFLKTTGEGLPPGPGGIYGATEGISYLVIVGVVGWSIYTKVKTGSGLPGSFLGAVE… |
| A0A7S3T221 | 29-168 | None |
| A0A830HGC0 | 61-170 | None |
| A0A7R9TWS4 | 12-125 | None |
| A0A7R9UN66 | 16-148 | None |
| A0A7S4CT94 | 159-273 | None |
| A0A7G2EQ31 | 423-565 | None |
| A0A7S0ZCU9 | 27-179 | None |
| Q9SCQ8 | 11-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.