DPCstruct | MC7891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6U1S4 | 148-274 | PCPPGNYCPNVTIQKTCPSGYFCRNGSVKPQECPILSICKKGSSAPVSAPGGVLLIFAILLVMLLLLLCFNHEEKLIEWCERYVTKR… |
| A0A150GGM2 | 1-114 | MCPRSLVRAGEFCPASWKNLTCWQGHYCKPQSIYPVKCPMLTPCPEGTAYPRAYRMTGLLVAVILFGMVLALRLSRGIADLIQRFIR… |
| A0A093X906 | 70-171 | None |
| A0A2B4RFC4 | 66-185 | None |
| A0A061RKH7 | 160-269 | None |
| A0A287F5E0 | 135-262 | None |
| A0A2S7QMB7 | 73-187 | None |
| A0A5Q4BD70 | 1-107 | None |
| A0A822G4H0 | 76-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.