DPCstruct | MC7890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 262 ± 51 aa |
| Standard deviation of domain lengths | 50.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4XDG9 | 19-252 | LSSLGRSMDSLPPEMSHSVKQGILSTELLQQWLHWEQRYLLRQLLRFPGMRERVLGDAAFLMKLGVEAGMGVITKLLAELHKRPVKF… |
| A0A7S0P1M1 | 6-224 | TLGFVRARLLAEPRLLSILSIEIGLGCACTLLADKAARGSKFVAELDFALANQVLISLTNTALVFALCPAAPLGAAATGGAAKLLSS… |
| A0A3M7KXQ8 | 976-1250 | None |
| A0A5D2PV55 | 393-554 | None |
| A0A6A1V2Z2 | 68-398 | None |
| A0A5N6P190 | 53-361 | None |
| A0A3B5Y308 | 396-678 | None |
| C5Y9I4 | 31-235 | None |
| A0A7S0KU34 | 137-466 | None |
| A0A7R9TY66 | 45-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.