DPCstruct | MC789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2URE7 | 231-325 | AKESTDLITAEVEKIKHQIKELEPTKIFFDLEISVTPTLIICIVDGKVCNAVSSCSSTQTCYLCRAKPNEMNNLRVISKKEASKEFL… |
| A0A4Y2HHR3 | 1-84 | MFTKETLNVIKTEVKRIKEQVIALLPTKININDMKVSVKPMLIFCMIDGKICNAVVGCESTQTCYLCDAKPSEMNDEMIIMQKT |
| A0A2W1BF04 | 282-396 | None |
| A0A4Y2D5V2 | 32-133 | None |
| Q17F27 | 210-300 | None |
| A0A6A4VAW7 | 37-124 | None |
| A0A6G0YFX2 | 187-283 | None |
| A0A4Y2GE77 | 367-452 | None |
| A0A4Y2GH80 | 6-119 | None |
| J9LPW1 | 222-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.