DPCstruct | MC7889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.24 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF17098- PF11805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4Q1Q6 | 1-107 | MESNTIMNLVEEKDKKVKELQDNVAAVNFTPQSKMGKMLMAKCRTLQEENEDVGQLHSEGKIHELTMKLALQKSQNAELRNQCEGLY… |
| A0A5J4XBD9 | 1-158 | MYIVRVYQVRQLLLDPAVNREFQRMHKALEDKSEEAQRLREELQGTTFQFDSKAGRMLVAKCRTLQEENEEMGRELSEDRVHKLERQ… |
| A0A2K3P531 | 121-246 | None |
| A0A287WE01 | 4-130 | None |
| A0A1Y1YFB4 | 65-186 | None |
| A0A2U1QI52 | 7-120 | None |
| A0A445L0I3 | 34-144 | None |
| A0A6P5MLP6 | 1-126 | None |
| A0A2P2LTR4 | 113-226 | None |
| A0A843U2Y5 | 54-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.