DPCstruct | MC7885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 247 ± 53 aa |
| Standard deviation of domain lengths | 52.55 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.34 |
| Pfam Score | 54.14 |
| Assigned Pfam label(s) | CL0763- PF10758- PF11863- PF05943- PF04984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9VGL6 | 25-248 | AVVIVDGPNTNDADAIKYAEQVSSERVYMVDPFVKVFNVDTKTYQDQPMSARVAGIISRTDNDLGFWWSPSNQPINGISNLSRAVDF… |
| R6YUK1 | 21-208 | EGVVNVKNTTVEDDSALVYWVTGVIAGCEINRSNTNKTYDGEYTVNADYTQAQLENSIDNGEFILHKVGDEVRVLVDINSLVDITSE… |
| A0A6M0F244 | 129-344 | None |
| A0A843FAQ0 | 256-549 | None |
| A0A2X3KXT0 | 2-133 | None |
| A0A843GHW6 | 26-227 | None |
| A0A7Z7I241 | 888-1148 | None |
| A0A4R0KMV3 | 16-230 | None |
| I4HNE8 | 122-371 | None |
| A0A4Q2ZDW1 | 591-816 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.