DPCstruct | MC7881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212SWC5 | 236-296 | ASGFARGFRLVHTDGRTLDGTVFPSGRCFVLDDPEYGFATVAASVEELLRGGYHGARIEWA |
| A0A7K2M2L5 | 1-65 | MSTPGGRAFRLHLPHGLVLDGWVTADGQAVAIEDADLGLTAAAASLEDLARGYGGAHIQWAPPTQ |
| F2R687 | 241-298 | None |
| A0A5Q4SWD0 | 3-67 | None |
| A0A6G7P6A7 | 10-69 | None |
| A0A1V9K958 | 66-126 | None |
| A0A2T0PP47 | 1-62 | None |
| A0A3D9QGS2 | 84-145 | None |
| A0A6I5MWP1 | 4-59 | None |
| A0A3R9UQ95 | 190-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.