DPCstruct | MC788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 242 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IV36 | 9-244 | RCGRLIESARRDFLKYYLKKCPSLFHICYDPIGTHRKARAFIGFLFGFVAAVVLYEGIIVDLQFDTYTSISLGAILVAMLSIGCASS… |
| A0A4Y2H5T5 | 1-264 | MLPGHRSGVSRRPCLAGSFENLTLRSFLGFLLGLLLTTAIFFFLLYQLNCSPRITTFICCVLGVILTNGLAFKPEVRCIVLLALPSL… |
| A0A834FNQ2 | 32-274 | None |
| A0A1S3IFN8 | 291-492 | None |
| A0A3Q7UKZ2 | 1-259 | None |
| A0A7M7LSQ9 | 569-835 | None |
| A0A2I4CVA2 | 1-252 | None |
| A0A5J4NB95 | 37-304 | None |
| A0A6A4X2Z6 | 16-274 | None |
| A0A2G8JJ36 | 1-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.