DPCstruct | MC7879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091CD55 | 2-101 | NQVPRGQSEVELPNYYKENQPLIISLDPALSPSQNAQRYFQRYQKLRNAVKVVGQQIQETKDELTYLESVMAQIELASPKDLKIIRE… |
| M1WPL7 | 5-109 | QTWEPGMAEIKLPDFETGEPVRIPLEVNKNAVQNAQYLYKKHQKLKRANKLVKPLLIEVMAEINYLQHVEASIIQIDSYKSLIDLQT… |
| A0A2T2U923 | 1-107 | None |
| A0A830Z0E9 | 333-435 | None |
| A0A7C7DJK2 | 473-581 | None |
| A0A831JZ28 | 130-233 | None |
| F7JVR5 | 62-164 | None |
| J1P181 | 205-302 | None |
| T0US00 | 2-97 | None |
| C9MYQ8 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.