DPCstruct | MC7877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6NUB0 | 21-138 | TLNLMPAVKELHRLNSQDLCRLLKDAGNFSIHYRTGKGVLLEIDMDKLARSLPLHLTTTLIYSSRDEVVFRYVLCGIRLLHSLCDLS… |
| A0A3N6RFA1 | 1-104 | MSGLLEPNQVVAAVKGLHWRTSLEIHKLLKDNEDFCITYNDGEEGAEPEKIDVEKLVGMLPLHLLSVFISSDEEDGKLGYLLSGIRL… |
| A0A7J7KZT7 | 1-100 | None |
| A0A1D6PPE8 | 1-114 | None |
| A0A7I4ESG1 | 8-119 | None |
| A0A7N2KPV4 | 16-136 | None |
| A0A453DKK5 | 4-94 | None |
| A0A5D3DAH8 | 12-110 | None |
| A0A0P0WIY4 | 3-77 | None |
| A0A6S7L7I0 | 43-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.