DPCstruct | MC7875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 2 aa |
| Standard deviation of domain lengths | 1.86 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 58.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8SYV0 | 862-946 | GPYFGLEAIWDEHTMYEFAERSVEKTMATMVQEPYVNHLPTLTGGIGRENLTAFYRDHFIFSNPADTELELISRTVGIDRVVDEF |
| A0A0D7BHQ6 | 83-169 | GPNFPLEEIWDEHAYFEFEIRSVARTMGTMVAEPYVNHIPTMTGGIGRKALTEFYRDHFIFVNPPDTTLESISRTVGADRLVDEFIF |
| A0A401KUE5 | 209-294 | None |
| A0A2J6TIB8 | 214-300 | None |
| A0A364MST9 | 402-484 | None |
| A0A316YZ72 | 180-265 | None |
| A0A140KMX0 | 282-368 | None |
| A0A7H8R2B1 | 522-604 | None |
| A0A5N6VSF0 | 53-140 | None |
| A0A0U1M1W6 | 479-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.