DPCstruct | MC7872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1XHJ4 | 77-149 | NIRRTRLENLLHRLFAPAQIELTLQDRFGHAVKPREWFLVPLAVIDQAVRAIEGGSVTRLRYDPASAALLPVD |
| A0A539CUN8 | 3-82 | LIESYNINRSRLENLLHRVFSAARLDLMIEDRFGQPVKPKEWFLVPLVVIDEVVDKIRDGSIIEFEYDPPTASLRKTTVA |
| A0A2D5ZGR0 | 503-576 | None |
| A0A2E4R9K5 | 141-207 | None |
| A0A7C5GV43 | 89-159 | None |
| A0A1V4GPC5 | 251-316 | None |
| A0A074J9T6 | 162-233 | None |
| A0A2N2RX98 | 273-343 | None |
| A0A0R3MT98 | 49-128 | None |
| A0A6P2AMA1 | 39-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.