DPCstruct | MC7871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 244 ± 27 aa |
| Standard deviation of domain lengths | 27.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3H5W4 | 2-199 | DAAAFQRGIPLPEHPGNGDEARYPSRFASYSKGLPHDGLGDVDTLEYDKLLAAIASGNPLDFEAITLGGSRKLVNPQAAYAYQLEGA… |
| A0A539CTJ3 | 5-218 | TTPATSNRVPRSFALRTETAGQDAFSPAPPEFDNGDEALYSDKSGTDTKGILQTGIGLVDLAAYETFKNALDSGTPADFEAITLGGP… |
| A0A6J4LXF7 | 191-416 | None |
| A0A6C0D019 | 1-254 | None |
| A0A433VW62 | 54-303 | None |
| A0A522TDW4 | 2-228 | None |
| A0A7W1SX17 | 1-263 | None |
| A0A7Y4KPB1 | 1-226 | None |
| A0A7Y9NP90 | 1-280 | None |
| K7ZUA3 | 2-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.