DPCstruct | MC7870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H5X6 | 101-161 | TLSDINNTLSIALGGSYVNDFIDRGRVKKVYIQGDAGARMTPEDLKKWYVRNSAGEMVPFS |
| A0A379WZW7 | 179-237 | LTDIFETLQINLGSLYVNDFNRFGRTWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPL |
| A0A2X1QL40 | 160-222 | None |
| A0A1W1YG45 | 90-147 | None |
| A0A378VWC3 | 33-94 | None |
| A0A2U2N3C2 | 429-491 | None |
| A0A6M1QB12 | 152-209 | None |
| A0A498F6S3 | 54-116 | None |
| A0A844BQ84 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.