DPCstruct | MC787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3DIK3 | 45-112 | LRLFVSNRPNVCGSRFNSYCCPGWKTLAGGNQCIVPICRSSCGDGFCSRPNMCTCSNGQLSPNCGGGA |
| Q75N89 | 54-117 | KGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQ |
| A0A6F8ZRX2 | 1-75 | None |
| A0A4S2L225 | 23-101 | None |
| A0A811WTJ4 | 52-121 | None |
| A0A4W5N264 | 30-96 | None |
| A0A074Z9B1 | 28-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.