DPCstruct | MC7869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6QXH2 | 3-189 | SATTSRDADEEWELYNDDGFVYKRKKRRLDPAAAAAAAAAQTNVDPQAEERSRRERKRRTLLKLKAQYQREIDQWELLSNMLSSMEE… |
| A0A0B2QHI5 | 4-163 | DQLELCNDDGFVFKRKRRRVDAPPPPPSEPEQEAAEKFRRERKKQTLLKLKSKYEKEILQWESFSNTLRSMQQLHTTPQQQPQPNLS… |
| A0A7I8JCY0 | 1-187 | None |
| A2X6Q7 | 1-177 | None |
| A0A4D9A3J9 | 4-177 | None |
| A0A804NSW0 | 3-177 | None |
| A0A438H1Y1 | 1-174 | None |
| A0A5A7UQ56 | 106-282 | None |
| Q6ZI57 | 1-177 | None |
| A0A3L6F2N2 | 12-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.