DPCstruct | MC7868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 192 ± 29 aa |
| Standard deviation of domain lengths | 29.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 54.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446RBR4 | 43-239 | TGRLWIHAASKVPDPDTVAAMEDFYREIYAVDGVHHIDFPQHYPVSRLLGCVEVVGCVRSEELVCWEDVPQSVRLEGLTDFCWLCEN… |
| A0A5N6QSZ4 | 269-447 | MEDFYREIYAVNGITDLKFPEHYPVSRLLGCVEVVGCVRGEELAGWDMVAEGVRLEALTKFCWLCEQPQKLLIPFEMRGYQGVYNLE… |
| A0A6A6MP10 | 7-165 | None |
| A0A4U5QRS0 | 1-180 | None |
| A0A059B5R0 | 40-218 | None |
| A0A6A6M396 | 4-161 | None |
| A0A059B7A0 | 107-298 | None |
| A0A7J7MJ27 | 18-202 | None |
| F6H8N8 | 73-247 | None |
| A0A6J5VIF0 | 22-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.