DPCstruct | MC7867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318H3A1 | 211-343 | FVDPTVFYFDDMWWMFSTTPRNDVLNIHFSEQLESGWTPHTMNPIIRDDANISRPGGGVIIRNGRPIRFAQDADPEYGIQVRAFEIT… |
| A0A3A6BSZ7 | 6-124 | LYLFNFDYEKMVIDDKPVQKVKFGGKVARNAGEVFVVDGQYYRPAQDCNKNYGNGIVIQRIESVGERFLFSEVKTFFSTNKKMDLGY… |
| A0A2A5GTA1 | 44-129 | None |
| A0A2U1QED1 | 171-279 | None |
| A0A7I6Y372 | 58-177 | None |
| A0A5C6D9C7 | 461-640 | None |
| A0A5S5DPP8 | 374-512 | None |
| R9UNT5 | 14-133 | None |
| A0A7V5IZ86 | 2-121 | None |
| A0A2N9PDY4 | 171-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.