DPCstruct | MC7866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q8SUI2 | 11-212 | GIDKVKKLSGKYTGLLTDEVFYTQGSNTGIHMNICTASLPNYEKFIVSPKSEINYHLAGYGTNLNDSLTRLGGESVERAAGAVSQLY… |
| A0A6M1CL04 | 1-162 | GKDAALEDSISRFQQKLQQLGFNIEEASWLNPVPNVWSVHIRDTDCPLCFTNGKGATKKAALASALGEYFERLSTNYFFADFWLGET… |
| A0A6B9HWJ4 | 46-212 | None |
| A0A401R4D2 | 267-471 | None |
| A0A7W3TFH2 | 16-209 | None |
| A0A7V0TNY7 | 4-221 | None |
| A0A7R9NDJ1 | 19-165 | None |
| A0A2R4SXH8 | 386-612 | None |
| A0A0J5GWT2 | 113-291 | None |
| A0A7X8GKQ7 | 264-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.