DPCstruct | MC7864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 202 ± 35 aa |
| Standard deviation of domain lengths | 34.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376KKU3 | 87-218 | LVGLGFKPLYAAGLCLIVNTAPVAFGAMGIPILVAGQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMDGWRGIKETWPAVVVAGG… |
| A0A386RGI5 | 2-182 | IAFGLDPIRASVISLIANTTATAFGAIGLPILTLAEVTNLKQENLSFIVTLQLFVLVLLVPFILVILTEGSIKAVKGVGLITLMSGL… |
| A0A433Q1G4 | 126-363 | None |
| A0A7S0P860 | 117-289 | None |
| K1Y1T5 | 2-183 | None |
| A0A1J0LPE0 | 106-355 | None |
| A0A378FTR3 | 1-211 | None |
| A0A0H2V3T2 | 31-276 | None |
| W4TVZ1 | 7-243 | None |
| A0A379W299 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.