DPCstruct | MC7863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 193 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X8JCB8 | 2-196 | LLAKDIIVTQEAMDSTDSYDLVMSNIDVVNGLFSRYLNEEEICREALYSYYVDYYLAQVYNGGFSQFVYNCPNVTVFNLVGEGLEAI… |
| A0A1H1Q4D9 | 4-246 | TFSSVPFKTFETCIRTVPIRLRDYNAADPHVFSRAVSRVRNDLVVYGAYAYKELPGPLHVNHHIWQYAGQITSGGHEQFVANCGWSR… |
| A0A285CM78 | 2-198 | None |
| A0A2A3MFY8 | 6-160 | None |
| A0A3L7JEY7 | 374-569 | None |
| A0A1C3X3K3 | 48-243 | None |
| A0A419YVU3 | 8-201 | None |
| A0A4Q7FXE4 | 15-214 | None |
| A0A1X7GI23 | 10-233 | None |
| A0A0T7FBH5 | 2-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.