DPCstruct | MC7861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9Q9D6 | 1-102 | MNWIALPLLADKQIFRGAVFRFSGKHPFEDVVDFMLIDEGDSDIGLKLICSTGYHAGQTELILPKESGYENGGLSLDWLLANWEKWV… |
| A0A4Q8MRE3 | 58-173 | RNWVPLFELPDQSLWRGDVIRLPHHPSIGPHAGPVDLLLFELWGYDRILGLMMTKGYKAGMPWIYLPPESQGTNRLSLETTWLRENW… |
| A3X895 | 23-112 | None |
| A0A2R7P630 | 11-118 | None |
| A0A539DH48 | 4-128 | None |
| A0A4P8LQT3 | 1-96 | None |
| A0A0Q6G3L6 | 1-115 | None |
| A0A395Y644 | 41-133 | None |
| A0A4Y6ULY1 | 139-238 | None |
| A0A838M7H0 | 20-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.