DPCstruct | MC7858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 144 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7LKN9 | 5-129 | LLLRNAPEGTAAILINQPTEDQLNEFKPSELLVLDESFENFLLIPSGDVEEIALWQIEFDGTQLVRREAIYRNYDPHEEFILHLVTM… |
| A0A3D1RLC6 | 31-168 | NLSTKVNFKNNECIAIGYIEKGKEAQIKEKYFNSDIEYESLTTVVEGDEYQFIVIPKSLDATLRIWKYNVSENGELYSEELLLEAVG… |
| A0A1Q6KQB5 | 7-145 | None |
| A0A7H9AR33 | 16-150 | None |
| A0A1I1PQN6 | 17-147 | None |
| A0A3E2B0Y0 | 51-208 | None |
| R8VXC3 | 99-260 | None |
| A0A1E4LHE9 | 169-293 | None |
| A0A2P1G3V6 | 83-240 | None |
| A0A2P8EIQ6 | 488-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.