DPCstruct | MC7856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8ZB89 | 97-175 | QPMTDEYLVELLCDRIGASKNYLKDKYTDASPYEYNEKTKHTILTHLKTAQQIHDALYYLKEVGEDQFFKTVREELKRK |
| A0A6L5X848 | 90-169 | QPVQMPRRYVAEMLMDRIAASKTYMKEHYTQHEPLKYYIRGKAGDLMHPQTARELEGMLRILDVRGEAACFRYVKNYYLK |
| A0A1G8VLZ5 | 106-198 | None |
| A0A6S6QXJ2 | 1-82 | None |
| E5VNM3 | 97-184 | None |
| R7AH60 | 176-257 | None |
| A0A1E3A6K3 | 1-77 | None |
| R6PX22 | 62-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.