DPCstruct | MC7854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 163 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7YJZ0 | 1-169 | MMILWLLLLILWNAAAVGMSFLLLPGNWIMVITTVLFAGWQWDARPFSSATLVVIVLLALVGEGVEMFAGMGGARRAGAGIRGAIGA… |
| A0A3D0Z246 | 10-171 | SLIGGAEAIVLFISLTIMLLGLAGTVLPVLPGMPLVLLGIVIYGAVHGFAAVGTDLVFLAIVLTLISLILDYLAVILGAGRARASRQ… |
| A0A1V5WSD3 | 4-158 | None |
| A0A848CAD3 | 9-173 | None |
| A0A7T9IGQ5 | 11-180 | None |
| A0A101FYJ1 | 33-201 | None |
| A0A843TBL2 | 6-176 | None |
| A0A6A0IP81 | 118-297 | None |
| A0A2V7K1S7 | 79-251 | None |
| A0A2W1K6A4 | 46-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.