DPCstruct | MC7853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7RA91 | 3-167 | GFEEVGIAGSVHLREALTNCTDPLQAIEDFQSENGILLPTLQPALPLLDLHMIQRFAFHHSIMEELREKLMSRAQELAKSDTKGRFK… |
| W2TZ18 | 11-176 | NHPLLGAAKLRQSLTKTRKLNTLLNAVKKFQDENGIKMDTLPPALQLLDLHKIKRHDLYEQAAMDISEHVVARIRELGENGSFESIK… |
| A0A818NAH6 | 145-306 | None |
| A0A5J4Y9H1 | 74-232 | None |
| A0A662XR23 | 14-225 | None |
| A0A817G1X0 | 6-165 | None |
| A0A1V9ZPX2 | 17-169 | None |
| A0A1I8FVJ9 | 4-196 | None |
| A0A482S4G3 | 1-157 | None |
| C1E6S5 | 63-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.