DPCstruct | MC7852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 386 ± 44 aa |
| Standard deviation of domain lengths | 44.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3CYQ2 | 106-526 | VPLFYIPPGSTTPVLSLQHNGSKDSPQSQFACYWKPILSMDANFWQRWLHMHRITIILEHDMPVPKHLHVAGNNGRYSTIQCRISHS… |
| W2TWI6 | 1-294 | MHAERIILRSSNLPFNMFGEKNDIRIDCKAAEDKLHDLLREQSSFCLVQRQTYVTFVYGKSSSVPIYFYMVKVTLEPPCLVLRTAFL… |
| A0A067RR02 | 338-773 | None |
| A0A7R9EFA7 | 349-753 | None |
| A0A7E4RPS6 | 426-843 | None |
| A0A132A113 | 175-578 | None |
| A0A0S7JBA9 | 13-347 | None |
| A0A2G9RUN2 | 18-325 | None |
| H2YI44 | 105-500 | None |
| A0A368H8C8 | 510-960 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.