DPCstruct | MC7851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 230 ± 43 aa |
| Standard deviation of domain lengths | 42.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 94.70 |
| Assigned Pfam label(s) | CL0179- CL0214- CL0307- PF04675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1C5F2 | 26-245 | MLFSELAAYYQKLEDVSSRLKMIDIMADMFREASKDEVKDIIYMTEGVLAPSFEGLDFGVAEKLLEEAIAVATGLRKEDAEKAYKKY… |
| W2TVU1 | 96-320 | SKKAKGKDDVKNKGGKEGSKTSEEPNEESKYNSFNKFAKLCDVIATMSKYTDKSAAVKMFISRASVCFVCLDDYDGDLLTLVRLLLP… |
| A0A5B8MKA3 | 457-756 | None |
| A0A7C2TNI4 | 1-215 | None |
| A0A5K1JSX0 | 6-236 | None |
| A0A6J3C6P8 | 230-516 | None |
| A0A158QXM2 | 6-192 | None |
| A0A388LKC1 | 2-209 | None |
| A0A0D0U6B8 | 10-213 | None |
| I4YE06 | 283-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.