DPCstruct | MC785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7EM70 | 55-140 | FLSYCAPTSEHMEWRKIVIARKKPRPFYVQPVTFESANKTITLKNYPASNEGIIQSFIDRYSSQRKFGPAALKALKSVWDRDQAYF |
| A0A4Y2GSG4 | 1-86 | MYDKYSLVASEENKYPFLKYRKIVMDRKKPRRMFVQANTFLESDKVKLKTYPSTPEGMIQSWMERFQDVQVDDILEELWAKDKKHF |
| A0A1B6F9I7 | 186-277 | None |
| A0A430QUS8 | 340-412 | None |
| A0A448X6I3 | 16-101 | None |
| A0A7S3RZ42 | 2-90 | None |
| A0A7S2B0I0 | 32-111 | None |
| A0A1D2M2L7 | 176-268 | None |
| A0A7R9GQA1 | 133-219 | None |
| A0A7S1QQ34 | 230-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.