DPCstruct | MC7849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2TSA6 | 1-81 | MNFISEPMKVSDTAIKISGQGPSKCSESIMKLMFKYDSGAKNFSQIPTNHLGATIDGFSIQDQFWQKLKIPYSGAASHRNN |
| A0A182UJ16 | 399-455 | QIIKLYGTGPSQVDDVMFDKFFKYNSGGKCFAQVHTKHLTVTIDAFTIHNSLWQGKK |
| A0A815TNT8 | 1-61 | None |
| A0A3B4XC66 | 63-129 | None |
| J9EQL0 | 315-381 | None |
| T1PD48 | 564-623 | None |
| A0A0B2W524 | 827-894 | None |
| A0A7J5Y9W7 | 304-366 | None |
| A1ZAU8 | 1560-1629 | None |
| A0A4W5RKD3 | 1056-1116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.