DPCstruct | MC7848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 525 ± 79 aa |
| Standard deviation of domain lengths | 79.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.07 |
| Pfam Score | 91.47 |
| Assigned Pfam label(s) | CL0179- CL0063- CL0506 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2TRW1 | 1-533 | MSLLFRLKLQGDKVYILDLAAKLDETANFLCSEKWKTRSGSAVEFPAPFGRDLTKEEEYIADLDSKTGASLKLTILNRKGRIWTVVA… |
| A0A3P7KG16 | 1-401 | MVAGGGASVVYADTVCDLGGAGELANYGEYSGDPSETQTFEYAKTLLSVMTEGPPHPQGKVLIIGGSIANFTNVAKTFGGIVRAFEV… |
| A0A5K3G1G0 | 2-419 | None |
| A0A2G8KZQ4 | 42-579 | None |
| A0A0B7F7D5 | 122-736 | None |
| M5FQP0 | 122-734 | None |
| A0A182EC94 | 108-695 | None |
| A0A813IUX4 | 1-453 | None |
| Q4STH3 | 1-615 | None |
| A0A7R8ZMA5 | 3-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.