DPCstruct | MC7847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 34.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05216 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J6FCP2 | 2-171 | LLLIAGFISAAGLVWGFIYSLSWPSTLALVLKMIFRDFIALALLSAFIFYQTANRLLLSTSATGQREKVEFAYAFDVAVNAFWPLFL… |
| W2TQV1 | 7-198 | LSRFVRRFMHFKQMDFEFASWQMLYLLIQPQKVYRNFLYRKRTKDQFARDDPAFLVLLSLSLLFSSVFYAVALGLPLWGFVKFFLWV… |
| A0A7R9ADH0 | 20-246 | None |
| A0A4Y9Y5I9 | 2-230 | None |
| A0A540M9P1 | 9-190 | None |
| A0A0D9XBD8 | 1-175 | None |
| W7XKN4 | 52-273 | None |
| A0A7J6U5Q8 | 1-161 | None |
| A0A6P5G2R2 | 2-211 | None |
| A0A2G9S8L8 | 13-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.