DPCstruct | MC7845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4BCL5 | 49-243 | EKGIFTSGTWEEKSDEISFADFKFSVTHHYLVQESVDKEGKDEILEDAIPQSMQDLLCMNNDFPPRAHCLVRWYGLREFVVIAPAAH… |
| W2TPQ1 | 10-196 | WQSKSSSLNFGNSNKLKAAYYFPDLPSDVIEEIPCSESDGHLSAFCADIIDMEKDFIYHSNITTMFGVSEFIVISPADQIDDAIMTE… |
| A0A7I4C032 | 6-163 | None |
| A0A3P8NNP8 | 66-248 | None |
| A0A182JTW7 | 361-561 | None |
| A0A183U208 | 60-233 | None |
| A0A1I8GW07 | 103-281 | None |
| A0A5N5SQE5 | 55-265 | None |
| A0A182F603 | 57-236 | None |
| A0A453IA87 | 33-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.