DPCstruct | MC7844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 186 |
|---|---|
| Mean domain length (aa) | 498 ± 111 aa |
| Standard deviation of domain lengths | 111.25 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.00 |
| Pfam Score | 95.46 |
| Assigned Pfam label(s) | PF16959- CL0126- CL0760- PF19310- PF08439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2TP03 | 26-524 | EGMSALSPADYAAFNQAQNSVCEMCSINRDKLNRVASDVTICDKDLPPPCALKKIDLESIFRNEKDAARLSHLWISYLTELAREKPT… |
| A0A2U1NPI1 | 63-698 | EKMMDKLTVVWGAVNHLKAVKDTTELRSAIEEIQPEKVEFDLKLGQSKPIYEAFKAIRESPDWAGLSDAQKRIVESSIKEAVLSGVS… |
| A0A1I8IQS2 | 2-479 | None |
| A0A7R8XF70 | 26-351 | None |
| A0A084RNU1 | 240-910 | None |
| A0A7R9LFF3 | 4-299 | None |
| A0A0M8WP49 | 22-507 | None |
| A0A7R8WZ97 | 551-1186 | None |
| A0A2Y9PNE9 | 199-756 | None |
| A0A7R8XDL7 | 251-656 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.