DPCstruct | MC7843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4HSX0 | 165-254 | AFVHRVNNEGDGDPFYETVGLVTLEDVIEELIQAEIVDETDVFVDNRTKTRRNRYKKADFSAFAERREIQAVRISPQLTLATFQYLS… |
| W2TNH3 | 7-94 | AMVQRIVYTEDSDPTYELVGVVTLEDIVEEILQAEIVDETDAIMDNVNRTRRRGAQARDVSCLMDTDEPSRVISVQMQLVAMQWLTTN |
| V9IDT3 | 39-129 | None |
| A0A819EBW1 | 1-89 | None |
| A0A671LSN6 | 89-179 | None |
| A0A6J0E7C0 | 248-343 | None |
| A0A556U353 | 456-577 | None |
| H2P736 | 5-92 | None |
| A0A2H1BUY7 | 13-119 | None |
| A0A444TWT6 | 21-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.