DPCstruct | MC7840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2TGJ6 | 11-133 | GWKVRGDFVPPESHERGPFFPRLRLIFDMVPMFIRAAIFTAKQWLQNEGVFINIFSQMKHNCYTGVPIGGIGSGSIGTDFRGAFNKF… |
| A0A811X8C3 | 13-142 | PKYGLKFRLNHEFPLQSKQIIKPTAKQLIEMLPLTTRYLFYYMDRKMHKKKPIMDYIHLVSAQRKYGCPIGGIGGGTIGRGFKGEFC… |
| A0A453S2P1 | 1-102 | None |
| A0A0A0KPF7 | 106-226 | None |
| A0A5C7ITM7 | 44-176 | None |
| A0A3L8S7D6 | 3-109 | None |
| A0A835S3U8 | 149-274 | None |
| A0A0R3TPJ5 | 18-144 | None |
| A0A482VFQ7 | 21-162 | None |
| A0A446JT82 | 23-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.