DPCstruct | MC784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 164 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5X4J7 | 55-228 | NPNARCPVCGDNVFFYQSPHGGRVYFDELGPPWPKHPCTDQTTIPDRPFALPKNHTYSWQKQGWTPFEVKKVRAEAAGLPSLYFTVI… |
| A0A8B5TR31 | 26-197 | PNAVCPVCAASVFYYQNDRGSRVFFDDLGPPWPKHPCTDNPTRSASAISARPQPRARGIRLELAEAASFLGIYDGGRFHSSGYPIDW… |
| A0A090DE48 | 20-185 | None |
| A0A503PNH2 | 1-137 | None |
| A0A329VZE3 | 39-186 | None |
| A0A5P8NPG1 | 1-200 | None |
| A0A239DT92 | 39-202 | None |
| A0A0C6FBJ7 | 52-211 | None |
| C5B0B3 | 1-156 | None |
| A0A329HK49 | 34-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.