DPCstruct | MC7838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4E7S3 | 117-192 | GFEHVFHGEIKKGKVSGFHNWVHYYELEKAGQINYLSYSYNGPWTTYPDILAIQYRWSSYLKSVGSFFIGSSPEFE |
| A0A0N4YDX9 | 135-203 | GWEHVFIGEWKKGTIDGQHDWTRYYLLQKTDHITYNGYYSFVDNLTGTIQYKWDDEFKKKGGFLIGTSP |
| A0A2G8L6H5 | 401-470 | None |
| C3ZKW4 | 182-250 | None |
| A0A2B4SEF9 | 412-486 | None |
| A0A0K0E792 | 223-291 | None |
| A0A2C9K4P1 | 246-318 | None |
| A0A812QK26 | 64-150 | None |
| A0A5A7TD16 | 292-386 | None |
| A0A811LLF6 | 353-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.