DPCstruct | MC7837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2T9L2 | 1-138 | MQLPMLTSELPEGWNLPSFLSVVVQIACIAPVMYAIVHKGCKSVEIPHIKLILFFLIMACVCQLGLVFLWKYTVVIGSRSYSVALYS… |
| A0A813E0U1 | 85-244 | KDNTSLWRMTLFYLFGMSAWWAGNVIFAQLPLLVAELPEADSLGSTLSMMIQTGNIVAITYKVVESQSDFINVSSVIQGMNQVSLLV… |
| A0A2H2I4R6 | 2-143 | None |
| A0A815AEN7 | 10-163 | None |
| A0A812G2X3 | 530-685 | None |
| A0A498M5E2 | 1-182 | None |
| A0A834U8L7 | 10-184 | None |
| A0A821RAT6 | 597-722 | None |
| A0A811KYZ1 | 9-174 | None |
| A0A183MTZ9 | 13-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.