DPCstruct | MC7835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7YAF6 | 1-163 | MNYKSMARLTAVAVIFMQLLIACGGLSSKQKTAAGDALKALRKIEAATQVGVNYQQYGQLVIDAKAQVNEASSALPDGELKKELNAT… |
| A0A3A0E0T1 | 121-265 | QRAADEARKLEEAIRLAKDDRRREAGRAYRNAPHSARVALNALKKVEARTEVGVIYADYSKVVGEMWGDVKIFIESPDGKKLPEFNI… |
| A0A315AZU8 | 94-256 | None |
| A0A1F9PEJ4 | 15-172 | None |
| A0A831T0E5 | 1-167 | None |
| A0A1V4Y4K6 | 1-192 | None |
| A0A1G3BIQ8 | 93-282 | None |
| A0A1Q7YDE3 | 47-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.