DPCstruct | MC7834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 175 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF08984- CL0397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1SNM4 | 1-165 | MKITAQTKISELIKQNPAALEAIVSINKHFEKLRNPILRKIMASRVSIADAAKIGGCKVEAFYEKLAPLGFETVNQVESQKAEPVIT… |
| A0A1Q7YAE8 | 1-186 | MRVTADMKIKDVLAINEHMIEAFRWLTPDFERLRNPRLRRLMAGRVSVHQAARIARVPLTEALYVLNLAAGEDEKQLTCEIEQMRPE… |
| A0A660T8Q5 | 1-167 | None |
| A0A661NTA6 | 122-312 | None |
| A0A1H2BFM5 | 155-324 | None |
| C7N2P8 | 1-191 | None |
| A0A2A4RRH2 | 3-195 | None |
| A0A353V6G8 | 108-287 | None |
| A0A3C1BCN0 | 6-156 | None |
| A0A7C3DXH1 | 36-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.