DPCstruct | MC7832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 21 aa |
| Standard deviation of domain lengths | 21.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5XWQ0 | 10-150 | HPKFPFTGYREDDEQYLMSQIYWLELIKSVTRQTQDVWVGWMAPPPDRDGSLIFSTFCPEFARGVIINQYAPTEDDTPPEQGGTYHP… |
| A0A2N7QNS0 | 1-122 | MNDFLFADFLDDHAVYAALQAYWDARLACFDGQCTPYLRTAFANGQPFYDGNPIVNLADRPKGKAARIVQQCPRKFGHDYTSFEQAI… |
| A0A829YC31 | 4-139 | None |
| A0A1Q4US40 | 5-154 | None |
| A0A316X672 | 5-136 | None |
| A0A2S0U7G1 | 17-130 | None |
| F4KU54 | 5-89 | None |
| A0A2K8UHH6 | 14-167 | None |
| A0A1Q3WDL0 | 1-169 | None |
| A0A6G8S4U6 | 14-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.