DPCstruct | MC7831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 292 ± 75 aa |
| Standard deviation of domain lengths | 75.32 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0175- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K2TX15 | 4-161 | EASLELWRELYDLAVEIKKLEPWKDFWSMDIIEIQLPGYQEPVYCSVMGKGGECYGIGLYEGADGLADFNMIATADEFMVPIEYVMG… |
| A0A3N5HNE8 | 2-275 | LHLFHLGPLRLLGRASYVLAGVDEQGGFSEPLIAQDLRAAVADLTKGLGPDNLRCEPGLADVAAEGIEIAPLPPEALVPRAVYAWAF… |
| A0A838V160 | 14-381 | None |
| A0A6P5FJC9 | 40-263 | None |
| G6FWN6 | 13-265 | None |
| A0A6G0XJY9 | 59-535 | None |
| A0A3L7PBA0 | 483-800 | None |
| A0A6T6B3W4 | 2-347 | None |
| A0A2H6A6U5 | 2-354 | None |
| A0A1F2VCP2 | 19-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.