DPCstruct | MC783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423GH77 | 4-82 | TYSAHDHANRNQAEILISNDCACFGCYAVFPASDVTRFTETTEWCPKCEAFSTVVGDASELPLDREFLEAVHDHWIGPQ |
| W7WK32 | 8-71 | SFNNRAELASARIAGCFSCLAIFEPSDVVSWTHGESTAVCPLCGADTVLPHVGSLATLRAVHAG |
| A0A416P7C4 | 109-194 | None |
| A0A1Q7LMI8 | 11-88 | None |
| L8H7N9 | 316-402 | None |
| A0A359BAE0 | 8-90 | None |
| A0A3S0BKV3 | 7-80 | None |
| A0A355U0Q2 | 4-69 | None |
| H9UHF2 | 48-130 | None |
| A0A7X6VE44 | 371-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.