DPCstruct | MC7829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4HZ66 | 91-259 | GELVVSLDTYDDIFSDFDPRPHAHRELSDDLLKELNRRYRENPKGGFEVSFYIPADIRAPKLEGVIRKRLKDHFLQERHKVRGQIKA… |
| A0A3N5HBP6 | 5-159 | LDPAPFREKDLEEAAERYLVDACREVGMRIPLKVVVYLPSDEAESPAARSLPEAVHHYFHYRERQVRADLLQLLRYGAASLAIGLMF… |
| A0A1S9BRS6 | 12-191 | None |
| R7GAT2 | 21-195 | None |
| A0A2G9PUL4 | 11-189 | None |
| A0A7C6WEF0 | 2-139 | None |
| A0A7J4JU71 | 58-240 | None |
| A0A1G3MSF8 | 2-170 | None |
| A0A449BIJ0 | 22-167 | None |
| A0A1G6DY86 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.