DPCstruct | MC7828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07670 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356ZC76 | 1-92 | MAGLMHLVGLPGEAALPLVMGYFLNIYAAIGALLPLGLTAKQISIMAAMLLMAHSLPMELAVNKKTGVKVKGLLLVRLVLSVTSGLL… |
| A0A139CXC2 | 2-114 | IPVYAVVTILKYTPAIEVISKWMTPLMGYLGLPGEAIMALISGYFLNIYAALAVITSLDLSPRAVTILGTMLGLSHSLLIETAIIKQ… |
| A0A845LEQ2 | 6-142 | None |
| A0A2V8TU72 | 12-168 | None |
| A0A7I8MUW6 | 41-195 | None |
| A0A0P8WW45 | 11-153 | None |
| A0A4R2RPR4 | 39-172 | None |
| A0A5S9MG98 | 6-137 | None |
| A0A1Y2T7G7 | 2-124 | None |
| A0A1V5F7X9 | 8-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.