DPCstruct | MC7826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 238 ± 33 aa |
| Standard deviation of domain lengths | 32.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0K908 | 21-204 | AESERERAERAAAAVAEHGSEEAVFADTPIEAALRTACEPLLGPGHTWDGVYELAGWSWLQGRDRMPAALRAAAAEAWRMPETVAAA… |
| A0A126NV28 | 13-295 | APVPKPSGFFDRFDDWCEAREPGYKAKEAQKAAARDKRRQERRAAVLKRFGSLDLVFALNPIEAALWKAATPFATRKVYRGWIGGAK… |
| A0A2S1XQ12 | 56-329 | None |
| A0A5A9EU56 | 64-276 | None |
| A0A7W4FBQ6 | 81-309 | None |
| A0A0Q5CFE4 | 204-487 | None |
| A0A7U8PKT3 | 2-243 | None |
| A0A850PHC9 | 1-249 | None |
| A0A318WUV7 | 7-207 | None |
| A0A6F8UUB1 | 1-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.