DPCstruct | MC7824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 66 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6EVX2 | 16-81 | VSDLLRLKQDLLLALKNEGFETCEWQREDNERNTWRSSCGELWSFVEGGPIENRVVFCQYCGKGLE |
| D7GWJ0 | 15-70 | CEWTLMDEEFNAYDTSCGNPWCLEEGTPEDNKMIYCPSCGRKIKVVKEKNKIWRRE |
| A0A3D2NKJ0 | 25-90 | None |
| A0A3D0JUK1 | 179-246 | None |
| A0A5K1S1T4 | 227-304 | None |
| A0A2E6JYW3 | 41-129 | None |
| A0A6G8BQL9 | 149-222 | None |
| A0A1H0C2U6 | 120-168 | None |
| A0A643ENF0 | 326-408 | None |
| A0A7V1BY58 | 68-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.