DPCstruct | MC7823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 390 |
|---|---|
| Mean domain length (aa) | 194 ± 35 aa |
| Standard deviation of domain lengths | 34.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 99.25 |
| Assigned Pfam label(s) | CL0063- PF01066- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3QWS3 | 2-207 | SLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSP… |
| A0A7Y2ING6 | 3-175 | WPDRIAYLRIALVPVIMALILYATDGGPGYVVALGVFIVAAVSDFLDGYLARRWDIATVLGGFLDSVADKLLVLGALTALVKVGRAW… |
| A0A2G8LA44 | 33-211 | None |
| A0A6P8HL94 | 1-213 | None |
| A0A0C2M8N0 | 19-224 | None |
| A0A1F6D114 | 1-216 | None |
| A0A538QQF1 | 54-247 | None |
| A0A4Q5L089 | 7-179 | None |
| A0A381E7N0 | 5-181 | None |
| Q1AW29 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.