DPCstruct | MC7821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 59.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T6A607 | 124-184 | FTPDFYLPQFDVYIELTTLKQDLVTRKNRKIRRLRELYPAVNLKVFYGRDYRKLLERFGIV |
| A0A1F5BKQ9 | 67-124 | FTPDFYLPDMDLYIELTTLNQKLVTKKNHKIKKIKELYPGINIKLFYKKDYHSLLFKY |
| A0A538MGG2 | 30-88 | None |
| A0A7V9P707 | 42-99 | None |
| A0A3B8VGY5 | 1-65 | None |
| A0A7V9D5Q0 | 25-85 | None |
| A0A538AU85 | 48-106 | None |
| A0A847FAH4 | 223-289 | None |
| A0A7X7VZM6 | 87-148 | None |
| A0A7C2JAL2 | 138-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.